Active Recombinant Mouse Il3 Protein (135 aa)

• Cat.No.: Il3-027I
• Product Overview: Recombinant Mouse Il3 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 135
• Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is < 0.05 ng/mL, corresponding to a specific activity of > 2 × 10^7 units/mg.
• Molecular Mass: Approximately 15.1 kDa globular protein containing 135 amino acid residues.
• AA Sequence: MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
• Endotoxin: Less than 1 EU/mg of rmIL-3 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il3 interleukin 3 [ Mus musculus ]
• Official Symbol: Il3
• Synonyms: IL3; interleukin 3; interleukin-3; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; BPA; PSF; HCGF; Il-3; MCGF; Csfmu
• Gene ID: 16187
• mRNA Refseq: NM_010556
• Protein Refseq: NP_034686
• UniProt ID: P01586