Active Recombinant Rat Il3 Protein, His-tagged
Cat.No. : | Il3-247I |
Product Overview : | Recombinant Rat Il3 Protein with a His tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | CHO |
Tag : | His |
Description : | Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 8 ng/mL, measured in a cell proliferation assay using NF S-60 cells. |
Molecular Mass : | 22-34 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il3 interleukin 3 [ Rattus norvegicus ] |
Official Symbol | Il3 |
Synonyms | IL3; interleukin 3; interleukin-3; IL-3; MCGF; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; |
Gene ID | 24495 |
mRNA Refseq | NM_031513 |
Protein Refseq | NP_113701 |
UniProt ID | F1LS41 |
◆ Recombinant Proteins | ||
Il3-591R | Recombinant Rat Interleukin 3 | +Inquiry |
Il3-576R | Recombinant Rat Il3 protein | +Inquiry |
IL3-140H | Recombinant Human IL3 Protein, Ala20-Phe152, N-His-Avi tagged, Biotinylated | +Inquiry |
IL3-455M | Active Recombinant Mouse IL3 Protein | +Inquiry |
IL3-2601H | Recombinant Human IL3 protein(41-130 aa), N-MBP & C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *
0
Inquiry Basket