Active Recombinant Rat Il3 Protein, His-tagged

• Cat.No.: Il3-247I
• Product Overview: Recombinant Rat Il3 Protein with a His tag was expressed in CHO.

Specification

• Species: Rat
• Source: CHO
• Tag: His
• Description: Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 8 ng/mL, measured in a cell proliferation assay using NF S-60 cells.
• Molecular Mass: 22-34 kDa, observed by reducing SDS-PAGE.
• AA Sequence: ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il3 interleukin 3 [ Rattus norvegicus ]
• Official Symbol: Il3
• Synonyms: IL3; interleukin 3; interleukin-3; IL-3; MCGF; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor
• Gene ID: 24495
• mRNA Refseq: NM_031513
• Protein Refseq: NP_113701
• UniProt ID: F1LS41