Active Recombinant Mouse Il25 Protein

Description :	Interleukin-25 (IL-25) – also known as interleukin-17E (IL-17E) – is a protein that in humans is encoded by the IL25 gene.
Source :	E. coli
Species :	Mouse
Form :	Lyophilized
Bio-activity :	The activity is determined by the dose-dependant production of IL-8 by human PBMCs. The expected ED50 for this effect is 322-488 ng/mL.
Molecular Mass :	35.5 kDa
AA Sequence :	MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Endotoxin :	< 0.1 EU/μg
Applications :	Functional Study SDS-PAGE
Storage :	Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	No additive
Tag :	Non

Gene Name	Il25 interleukin 25 [ Mus musculus ]
Official Symbol	Il25
Synonyms	IL25; interleukin 25; interleukin-25; interleukin 17E; Il17e; IL-17e;
Gene ID	140806
mRNA Refseq	NM_080729
Protein Refseq	NP_542767

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry