Active Recombinant Mouse Il24 Protein, His-Tagged
Cat.No. : | Il24-01M |
Product Overview : | Recombinant mouse Il24 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-24 (IL-24) is a cytokine belonging to the IL-10 family of cytokines that signals through two heterodimeric receptors: IL-20R1/IL-20R2 and IL-22R1/IL-20R2. This interleukin is also known as melanoma differentiation-associated 7 (mda-7) due to its discovery as a tumour suppressing protein. IL-24 appears to control in cell survival and proliferation by inducing rapid activation of particular transcription factors called STAT1 and STAT3. This cytokine is predominantly released by activated monocytes, macrophages and T helper 2 (Th2) cells and acts on non-haematopoietic tissues such as skin, lung and reproductive tissues. IL-24 performs important roles in wound healing, arthritis, psoriasis and cancer. Several studies have shown that cell death occurs in cancer cells/cell lines following exposure to IL-24. The gene for IL-24 is located on chromosome 1 in humans. |
Form : | Lyophilized powder |
AA Sequence : | MQEFRFGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNF IVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <0.3 ng/mL. |
Purity : | >95% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il24 interleukin 24 [ Mus musculus (house mouse) ] |
Official Symbol | Il24 |
Synonyms | FISP; If2e; Mda7; St16; Mda-7 |
Gene ID | 93672 |
mRNA Refseq | NM_053095.3 |
Protein Refseq | NP_444325.3 |
UniProt ID | A0A087WQD7 |
◆ Recombinant Proteins | ||
Il24-796M | Active Recombinant Mouse Il24 | +Inquiry |
IL24-934H | Recombinant Human IL24 Protein, His-tagged | +Inquiry |
IL24-2876H | Recombinant Human IL24 Protein (Gln52-Leu260), His tagged | +Inquiry |
IL24-8158M | Recombinant Mouse IL24 Protein | +Inquiry |
Il24-10583M | Recombinant Mouse Il24 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL24-1922HCL | Recombinant Human IL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il24 Products
Required fields are marked with *
My Review for All Il24 Products
Required fields are marked with *
0
Inquiry Basket