Active Recombinant Mouse Il22 Protein, His-Tagged

• Cat.No.: Il22-01M
• Product Overview: Recombinant mouse Il22 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interleukin-22 (IL-22) a member of a group of cytokines called the IL-10 family or IL-10 superfamily (including IL-19, IL-20, IL-24, and IL-26), a class of potent mediators of cellular inflammatory responses. It shares use of IL-10R2 in cell signaling with other members of this family, IL-10, IL-26, IL-28A/B and IL-29. IL-22 is produced by activated NK and T cells and initiates innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 is rapidly produced by splenic LTi-like cells and also produced by Th17 cells and likely plays a role in the coordinated response of both adaptive innate immune systems, autoimmunity and tissue regeneration.
• Form: Lyophilized powder
• AA Sequence: MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTK
  LSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce IL-10 secretion in COLO205 cells. The ED50 for this effect is <0.3 ng/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il22 interleukin 22 [ Mus musculus (house mouse) ]
• Official Symbol: Il22
• Synonyms: L-22; If2b1; Iltif; IL-22a; ILTIFa
• Gene ID: 50929
• mRNA Refseq: NM_016971.2
• Protein Refseq: NP_058667.1
• UniProt ID: Q14BB3