Recombinant Human IL22 Protein
Cat.No. : | IL22-512H |
Product Overview : | Recombinant human IL22 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 179 |
Description : | This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. The encoded protein is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2). |
Form : | Lyophilized |
AA Sequence : | MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL22 interleukin 22 [ Homo sapiens (human) ] |
Official Symbol | IL22 |
Synonyms | IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23; |
Gene ID | 50616 |
mRNA Refseq | NM_020525 |
Protein Refseq | NP_065386 |
MIM | 605330 |
UniProt ID | Q9GZX6 |
◆ Recombinant Proteins | ||
IL22-15H | Recombinant Human IL22 protein, His-tagged | +Inquiry |
IL22-563H | Active Recombinant Human IL22, HIgG1 Fc-tagged | +Inquiry |
IL22-60Z | Recombinant Zebrafish IL22 Protein, His-tagged | +Inquiry |
Il22-3514M | Active Recombinant Mouse Il22 Protein | +Inquiry |
Il22-001R | Active Recombinant Rat Il22, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL22 Products
Required fields are marked with *
My Review for All IL22 Products
Required fields are marked with *
0
Inquiry Basket