Active Recombinant Mouse Il21 Protein (123 aa)
Cat.No. : | Il21-361I |
Product Overview : | Recombinant mouse interleukin-21 (IL-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 123 amino acids. A fully biologically active molecule, rhIL-21 has a molecular mass of 15.1 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 123 |
Description : | Interleukin-21 (IL-21) belongs to the Type I four helix bundle cytokines, and shares the common cytokine receptor γ chain with IL-2, IL-4, IL-7, IL-9, and IL-15. IL-21 is expressed by CD4+ T cells, natural killer (NK) T cells, and Th17 cells. The IL-21 receptor is highly expressed on CD4+ and CD8+ B cells. IL-21 plays a pivotal role in the survival and proliferation of B cells, and their differentiation to immunoglobulin (Ig) producing cells. IL-21regulates the production of IgG1 and IgE by B cells, and diminishes the severity of allergy and asthma. In some cases, IL-21 induces B cell apoptosis. Other roles of IL-21 include regulation of the innate immune system, implication in autoimmunity, and antitumor activity. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 1 ng/mL, measured by its ability to stimulate the proliferation of human ANBL-6 cells, corresponding to a specific activity of > 1.0 × 10^6 units/mg. |
Molecular Mass : | 15.1 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant mouse interleukin-21 (IL-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, mouse interleukin-21 (IL-21) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il21 interleukin 21 [ Mus musculus ] |
Official Symbol | Il21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL-21; |
Gene ID | 60505 |
mRNA Refseq | NM_021782 |
Protein Refseq | NP_068554 |
UniProt ID | Q9ES17 |
◆ Recombinant Proteins | ||
Il21-3511M | Active Recombinant Mouse Il21 Protein | +Inquiry |
IL21-004H | Active Recombinant Human IL21, MIgG2a Fc-tagged | +Inquiry |
IL21-652H | Recombinant Human IL21 protein, MYC/DDK-tagged | +Inquiry |
IL21-630C | Active Recombinant Canine IL21 protein | +Inquiry |
IL21-864H | Recombinant Human IL21 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il21 Products
Required fields are marked with *
My Review for All Il21 Products
Required fields are marked with *
0
Inquiry Basket