Active Recombinant Mouse Il21 Protein (123 aa)

• Cat.No.: Il21-361I
• Product Overview: Recombinant mouse interleukin-21 (IL-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 123 amino acids. A fully biologically active molecule, rhIL-21 has a molecular mass of 15.1 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 123
• Description: Interleukin-21 (IL-21) belongs to the Type I four helix bundle cytokines, and shares the common cytokine receptor γ chain with IL-2, IL-4, IL-7, IL-9, and IL-15. IL-21 is expressed by CD4+ T cells, natural killer (NK) T cells, and Th17 cells. The IL-21 receptor is highly expressed on CD4+ and CD8+ B cells. IL-21 plays a pivotal role in the survival and proliferation of B cells, and their differentiation to immunoglobulin (Ig) producing cells. IL-21regulates the production of IgG1 and IgE by B cells, and diminishes the severity of allergy and asthma. In some cases, IL-21 induces B cell apoptosis. Other roles of IL-21 include regulation of the innate immune system, implication in autoimmunity, and antitumor activity.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 ng/mL, measured by its ability to stimulate the proliferation of human ANBL-6 cells, corresponding to a specific activity of > 1.0 × 10^6 units/mg.
• Molecular Mass: 15.1 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant mouse interleukin-21 (IL-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, mouse interleukin-21 (IL-21) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il21 interleukin 21 [ Mus musculus ]
• Official Symbol: Il21
• Synonyms: IL21; interleukin 21; interleukin-21; IL-21
• Gene ID: 60505
• mRNA Refseq: NM_021782
• Protein Refseq: NP_068554
• UniProt ID: Q9ES17