Recombinant Human IL21 Protein

• Cat.No.: IL21-864H
• Product Overview: Recombinant Human IL21, transcript variant 1, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Description: This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2
• Molecular Mass: 16.5kD
• AA Sequence: MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: IL21 interleukin 21 [ Homo sapiens ]
• Official Symbol: IL21
• Synonyms: IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21
• Gene ID: 59067
• mRNA Refseq: NM_001207006
• Protein Refseq: NP_001193935
• MIM: 605384
• UniProt ID: Q9HBE4