Active Recombinant Mouse Il1b Protein (153 aa)
Cat.No. : | Il1b-365I |
Product Overview : | Recombinant mouse Interleukin-1 Beta(rmIL-1β) produced in E. coli is a single non-glycosylated polypeptide chain containing 153 amino acids. A fully biologically active molecule, rmIL-1β is obtained by proprietary chromatographic techniques, with an apparent molecular weight of 17.5kDa analyzed by reducing SDS-PAGE. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 153 |
Description : | Interleukin-1 Beta (IL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 2.0 pg/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of> 5.0 × 10^8units/mg. |
Molecular Mass : | 17.5kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant mouseInterleukin-1 Beta(rmIL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-1β should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il1b interleukin 1 beta [ Mus musculus ] |
Official Symbol | Il1b |
Synonyms | IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; Il-1b; IL-1beta; |
Gene ID | 16176 |
mRNA Refseq | NM_008361 |
Protein Refseq | NP_032387 |
UniProt ID | P10749 |
◆ Recombinant Proteins | ||
Il1B-39H | Recombinant Human Il1B protein, low endotoxin | +Inquiry |
IL1B-101I | Active Recombinant Human IL1B Protein (153 aa) | +Inquiry |
Il1b-6735M | Recombinant Mouse Il1b Protein (Val118-Ser269) | +Inquiry |
IL1B-251E | Recombinant Horse IL1B protein | +Inquiry |
IL1B-3098S | Recombinant Sheep IL1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il1b Products
Required fields are marked with *
My Review for All Il1b Products
Required fields are marked with *
0
Inquiry Basket