Active Recombinant Mouse Il1b Protein (153 aa)

• Cat.No.: Il1b-365I
• Product Overview: Recombinant mouse Interleukin-1 Beta(rmIL-1β) produced in E. coli is a single non-glycosylated polypeptide chain containing 153 amino acids. A fully biologically active molecule, rmIL-1β is obtained by proprietary chromatographic techniques, with an apparent molecular weight of 17.5kDa analyzed by reducing SDS-PAGE.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 153
• Description: Interleukin-1 Beta (IL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 2.0 pg/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of> 5.0 × 10^8units/mg.
• Molecular Mass: 17.5kDa, observed by reducing SDS-PAGE.
• AA Sequence: MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant mouseInterleukin-1 Beta(rmIL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-1β should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il1b interleukin 1 beta [ Mus musculus ]
• Official Symbol: Il1b
• Synonyms: IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; Il-1b; IL-1beta
• Gene ID: 16176
• mRNA Refseq: NM_008361
• Protein Refseq: NP_032387
• UniProt ID: P10749