Active Recombinant Mouse Il1b Protein (153 aa)

Cat.No. : Il1b-365I
Product Overview : Recombinant mouse Interleukin-1 Beta(rmIL-1β) produced in E. coli is a single non-glycosylated polypeptide chain containing 153 amino acids. A fully biologically active molecule, rmIL-1β is obtained by proprietary chromatographic techniques, with an apparent molecular weight of 17.5kDa analyzed by reducing SDS-PAGE.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 153
Description : Interleukin-1 Beta (IL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 2.0 pg/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of> 5.0 × 10^8units/mg.
Molecular Mass : 17.5kDa, observed by reducing SDS-PAGE.
AA Sequence : MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant mouseInterleukin-1 Beta(rmIL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-1β should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Il1b interleukin 1 beta [ Mus musculus ]
Official Symbol Il1b
Synonyms IL1B; interleukin 1 beta; interleukin-1 beta; IL-1 beta; Il-1b; IL-1beta;
Gene ID 16176
mRNA Refseq NM_008361
Protein Refseq NP_032387
UniProt ID P10749

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1b Products

Required fields are marked with *

My Review for All Il1b Products

Required fields are marked with *

0
cart-icon
0
compare icon