Active Recombinant Mouse Il17f Protein, His-Tagged

Cat.No. : Il17f-01M
Product Overview : Recombinant mouse Il17f Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1.
Form : Lyophilized powder
AA Sequence : MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMN
SVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <100 ng/mL.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 20 mM sodium citrate,
pH 4.5.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il17f interleukin 17F [ Mus musculus (house mouse) ]
Official Symbol Il17f
Synonyms IL-17F
Gene ID 257630
mRNA Refseq NM_145856.2
Protein Refseq NP_665855.2
UniProt ID Q7TNI7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Il17f Products

Required fields are marked with *

My Review for All Il17f Products

Required fields are marked with *

0

Inquiry Basket

cartIcon