Active Recombinant Mouse Il17f Protein, His-Tagged

• Cat.No.: Il17f-01M
• Product Overview: Recombinant mouse Il17f Protein, His-tagged was expressed in E. coli cell

Specification

• Description: The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1.
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized powder
• AA Sequence: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMN
  SVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <100 ng/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 20 mM sodium citrate,
  pH 4.5.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il17f interleukin 17F [ Mus musculus (house mouse) ]
• Official Symbol: Il17f
• Synonyms: IL-17F
• Gene ID: 257630
• mRNA Refseq: NM_145856.2
• Protein Refseq: NP_665855.2
• UniProt ID: Q7TNI7