Recombinant Active Mouse IL17F Protein, His-tagged(C-ter)
Cat.No. : | Il17f-152M |
Product Overview : | Recombinant Active Mouse IL17F Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq, Jul 2008] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 100 ng/mL. |
AA Sequence : | MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | 20 mM Sodium citrate (pH 4.5) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | Il17f interleukin 17F [ Mus musculus ] |
Official Symbol | Il17f |
Synonyms | IL17F; interleukin 17F; interleukin-17F; C87042; IL-17F; |
Gene ID | 257630 |
mRNA Refseq | NM_145856 |
Protein Refseq | NP_665855 |
◆ Recombinant Proteins | ||
IL17F-6030C | Recombinant Chicken IL17F | +Inquiry |
Il17f-01M | Active Recombinant Mouse Il17f Protein, His-Tagged | +Inquiry |
IL17F-4332H | Recombinant Human IL17F Protein | +Inquiry |
Il17f-964M | Active Recombinant Mouse Il17f protein(Met1-Ala161), His-tagged | +Inquiry |
Il17f-498R | Active Recombinant Rat Interleukin-17F | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17F Products
Required fields are marked with *
My Review for All IL17F Products
Required fields are marked with *
0
Inquiry Basket