Active Recombinant Mouse Il10 Protein

• Cat.No.: Il10-261I
• Product Overview: Recombinant Mouse Il10 Protein without tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Description: Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.2 ng/mL, measured in a cell proliferation assay using MC/9 cells.
• Molecular Mass: 21-23 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il10 interleukin 10 [ Mus musculus ]
• Official Symbol: Il10
• Synonyms: IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10
• Gene ID: 16153
• mRNA Refseq: NM_010548
• Protein Refseq: NP_034678
• UniProt ID: P18893