Active Recombinant Rat Il10 Protein (160 aa)

• Cat.No.: Il10-006I
• Product Overview: Recombinant Rat Il10 Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 160
• Description: Interleukin-10 also known as cytokine synthesis inhibitory factor (CSIF), is coded by IL10 gene on chromosome 13 in rat. the charter member of the IL 10 family of α helical cytokines that also includes IL19, IL20, IL22, and IL24 (1, 2). IL10 is secreted by many activated hematopoietic cell types as well as hepatic stellate cells, keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNFα. Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 active on murine cells, but murine IL-10 is inactive on human cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Measured in a cell proliferation assay using MC/92 mouse mast cells. The ED50 for this effect is typically 2-12 ng/mL.
• Molecular Mass: Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 160 amino acid residues.
• AA Sequence: SKGHSIKGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
• Endotoxin: Less than 1 EU/μg of rRtIL-10 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il10 interleukin 10 [ Rattus norvegicus ]
• Official Symbol: Il10
• Synonyms: IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X
• Gene ID: 25325
• mRNA Refseq: NM_012854
• Protein Refseq: NP_036986
• UniProt ID: P29456