Active Recombinant Mouse Il10 Protein (161 aa)

• Cat.No.: Il10-029I
• Product Overview: Recombinant Mouse Il10 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 161
• Description: IL-10 is an immunosuppressive cytokine produced by a variety of mammalian cell types including macrophages, monocytes, T cells, B cells and keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNFα. Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 active on murine cells, but murine IL-10 is inactive on human cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells was found to be < 2 ng/mL, corresponding to a specific activity of > 5 × 10^5 units/mg.
• Molecular Mass: Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 161 amino acids
• AA Sequence: MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS
• Endotoxin: Less than 1 EU/mg of rMuIL-10 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il10 interleukin 10 [ Mus musculus ]
• Official Symbol: Il10
• Synonyms: IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10
• Gene ID: 16153
• mRNA Refseq: NM_010548
• Protein Refseq: NP_034678
• UniProt ID: P18893