Active Recombinant Mouse Il10 Protein (161 aa)
Cat.No. : | Il10-029I |
Product Overview : | Recombinant Mouse Il10 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 161 |
Description : | IL-10 is an immunosuppressive cytokine produced by a variety of mammalian cell types including macrophages, monocytes, T cells, B cells and keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNFα. Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 active on murine cells, but murine IL-10 is inactive on human cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells was found to be < 2 ng/mL, corresponding to a specific activity of > 5 × 10^5 units/mg. |
Molecular Mass : | Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 161 amino acids |
AA Sequence : | MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Endotoxin : | Less than 1 EU/mg of rMuIL-10 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il10 interleukin 10 [ Mus musculus ] |
Official Symbol | Il10 |
Synonyms | IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10; |
Gene ID | 16153 |
mRNA Refseq | NM_010548 |
Protein Refseq | NP_034678 |
UniProt ID | P18893 |
◆ Recombinant Proteins | ||
IL10-326H | Active Recombinant Human IL10, Fc-tagged | +Inquiry |
IL10-2678R | Recombinant Rat IL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il10-006I | Active Recombinant Rat Il10 Protein (160 aa) | +Inquiry |
IL10-37B | Recombinant Bovine IL-10 | +Inquiry |
IL10-20R | Recombinant Rhesus monkey IL10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket