Active Recombinant Mouse Il10 Protein

• Cat.No.: Il10-082M
• Product Overview: Purified recombinant protein of Mouse interleukin 10 (Il10) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes an anti-inflammatory cytokine that is a member of the class-2 cytokine family. The encoded protein is secreted by cells of both the innate and adaptive immune systems and is crucial for limiting the immune response to a broad range of pathogens. It also has been shown to suppress autoimmune responses. This protein mediates it's immunosuppressive signal through a specific interleukin 10 receptor complex. Aberrant functioning of this gene is associated with numerous immune disorders including graft-versus-host disease, and increased susceptibility to HIV-1 infection and rheumatoid arthritis.
• Bio-activity: The biological activity of murine IL-10 is measured by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells. The ED50 was found to be > 2 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg.
• Molecular Mass: 18.7 kDa
• AA Sequence: MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il10 interleukin 10 [ Mus musculus (house mouse) ]
• Official Symbol: Il10
• Synonyms: Il10; interleukin 10; CSIF; Il-10; interleukin-10; cytokine synthesis inhibitory factor
• Gene ID: 16153
• mRNA Refseq: NM_010548
• Protein Refseq: NP_034678
• UniProt ID: P18893