Active Recombinant Mouse Hgf Protein

• Cat.No.: Hgf-4731M
• Product Overview: Mouse Hgf (Q08048) full length recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) Insect cells.

Specification

• Description: This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the hepatocyte growth factor alpha and beta chains, which heterodimerize to form the mature active protein. Although this protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Homozygous knockout mice for this gene exhibit embryonic lethality due to impaired development of the placenta and liver. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]
• Source: Insect Cell
• Species: Mouse
• Form: Lyophilized
• Bio-activity: Determined by the dose-dependent stimulation of the proliferation of mouse IMCD3 cells using a concentration range of 10-20 ng/mL.
• AA Sequence: alpha chain: QKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR
  Beta chain: VVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL
• Endotoxin: Endotoxin level is < 0.1 ng/μg (< 1 EU/μg).
• Purity: 95%
• Applications: Functional Study
  SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -2 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein
• Tag: Non
• Full Length: Full L.

Gene Information

• Gene Name: Hgf hepatocyte growth factor [ Mus musculus ]
• Official Symbol: Hgf
• Synonyms: HGF; hepatocyte growth factor; SF; scatter factor; hepatopoeitin-A; hepatopoietin-A; NK1; NK2; HGF/SF; SF/HGF; C230052L06Rik
• Gene ID: 15234
• mRNA Refseq: NM_010427
• Protein Refseq: NP_034557