Active Recombinant Mouse Glo1 Protein, His-tagged

• Cat.No.: Glo1-7146M
• Product Overview: Recombinant Mouse Glo1 Protein with a His tag.

Specification

• Description: Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis.
• Species: Mouse
• Tag: His
• Form: Liquid
• Bio-activity: Specific activity is > 210 units/mg, and is defined as the amount of enzyme that will form 1.0 μmol of S-lactoylglutathione from methylglyoxal and reduced glutathione per minute at pH 6.5 at 25 centigrade.
• Molecular Mass: 21.8 kDa
• Protein length: 1-184
• AA Sequence: MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATIILEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Glo1 glyoxalase 1 [ Mus musculus (house mouse) ]
• Official Symbol: Glo1
• Synonyms: Glo1; glyoxalase 1; Qg; Glo; GLY1; Qglo; Glo-1; Glo-1r; Glo-1s; Glo1-r; Glo1-s; AW550643; 0610009E22Rik; 1110008E19Rik; 2510049H23Rik; lactoylglutathione lyase; S-D-lactoylglutathione methylglyoxal lyase; aldoketomutase; glx I; glyoxalase 1 complex; glyoxalase 1 regulatory; glyoxalase 1 structural; glyoxalase I; ketone-aldehyde mutase; methylglyoxalase; EC 4.4.1.5
• Gene ID: 109801
• mRNA Refseq: NM_001113560
• Protein Refseq: NP_001107032
• UniProt ID: Q9CPU0