Active Recombinant Mouse Gdnf Protein

• Cat.No.: Gdnf-278G
• Product Overview: Recombinant Mouse Gdnf Protein without tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Description: Glial-Derived Neurotrophic Factor, also known as GDNF and ATF-1, is a neurotrophic factor belonging to the TGF-beta family. It is expressed in both central nervous system (CNS) and non-CNS tissues. GDNF signals through a receptor system composed of a RET and one of the four GFR alpha receptors. It promotes the survival and differentiation of dopaminergic neurons, and increases their high-affinity dopamine uptake. In a mouse Parkinson’s Disease model, GDNF has been shown to improve bradykinesia, rigidity, and postural instability. GDNF has also been shown to regulate kidney development, spermatogenesis and affect alcohol consumption.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 8μg/mL, measured in a bioassay using C6 cells.
• Molecular Mass: 17-22 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant murine GDNF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine GDNF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Gdnf glial cell line derived neurotrophic factor [ Mus musculus ]
• Official Symbol: Gdnf
• Synonyms: GDNF; glial cell line derived neurotrophic factor; glial cell line-derived neurotrophic factor; ATF; mGDNF; neurotrophic factor; astrocyte-derived trophic factor; AI385739
• Gene ID: 14573
• mRNA Refseq: NM_010275
• Protein Refseq: NP_034405
• UniProt ID: P48540