Active Recombinant Mouse Flt3l Protein, His-tagged

• Cat.No.: Flt3l-285F
• Product Overview: Recombinant Mouse Flt3l Protein with a His tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Tag: His
• Description: Flt3L, also known as Fms-related tyrosine kinase 3 ligand and SL cytokine, is a single-pass type I membrane protein. It is expressed by stromal cells and T cells. Flt3L signals through tyrosine kinase receptor Flt3/Flk2 to stimulate the proliferation of early hematopoietic progenitor cells. It synergizes with other growth factors, such as GM-CSF, IL-3 and CSF, to promote the differentiation of both myeloid and lymphoid cells. Alternative splicing and proteolytic cleavage of membrane-bound Flt3L generates a soluble extracellular domain (ECD) isoform with full biological activity.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 ng/mL, measured in a cell proliferation assay using AML5 cells.
• Molecular Mass: 24-30 kDa, observed by reducing SDS-PAGE.
• AA Sequence: GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRHHHHHH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant murine Flt3L, His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Flt3L, His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ]
• Official Symbol: Flt3l
• Synonyms: Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand
• Gene ID: 14256
• mRNA Refseq: NM_013520
• Protein Refseq: NP_038548
• UniProt ID: P49772