Active Recombinant Mouse Flt3l Protein

• Cat.No.: Flt3l-064M
• Product Overview: Purified recombinant protein of Mouse FMS-like tyrosine kinase 3 ligand (cDNA clone MGC:30232 IMAGE:5132319) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
• Bio-activity: Determined by the dose-dependent stimulation of the proliferation of human AML5 cells. The expected ED50 for this effect is 5.0 - 8.0 ng/ml.
• Molecular Mass: 18.6 kDa
• AA Sequence: MTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ]
• Official Symbol: Flt3l
• Synonyms: Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand
• Gene ID: 14256
• mRNA Refseq: NM_013520
• Protein Refseq: NP_038548
• UniProt ID: P49772