Active Recombinant Mouse Flt3l Protein
Cat.No. : | Flt3l-064M |
Product Overview : | Purified recombinant protein of Mouse FMS-like tyrosine kinase 3 ligand (cDNA clone MGC:30232 IMAGE:5132319) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of human AML5 cells. The expected ED50 for this effect is 5.0 - 8.0 ng/ml. |
Molecular Mass : | 18.6 kDa |
AA Sequence : | MTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ] |
Official Symbol | Flt3l |
Synonyms | Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand |
Gene ID | 14256 |
mRNA Refseq | NM_013520 |
Protein Refseq | NP_038548 |
UniProt ID | P49772 |
◆ Recombinant Proteins | ||
FLT3L-1888H | Active Recombinant Human FLT3L protein | +Inquiry |
Flt3l-26M | Active Recombinant Mouse Flt3l Protein (Gly27-Arg188), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FLT3L-20H | Active Recombinant Human FLT3L, His-tagged | +Inquiry |
Flt3l-457M | Recombinant Mouse Flt3l protein, His-tagged | +Inquiry |
Flt3l-03M | Active Recombinant Mouse Flt3l | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-1387MCL | Recombinant Mouse FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Flt3l Products
Required fields are marked with *
My Review for All Flt3l Products
Required fields are marked with *
0
Inquiry Basket