Active Recombinant Mouse Fgf21 Protein (182 aa)

• Cat.No.: Fgf21-414F
• Product Overview: Recombinant Mouse Fibroblast Growth Factor-21(FGF-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 182 amino acids. A fully biologically active molecule, rmFGF-21 has a molecular mass of 19.9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 182
• Description: Fibroblast growth factor-21 (FGF21) belongs to the large FGF family which has at least 23 members. Along with FGF-19/15 and FGF-23, FGF-21 is categorized as a member of the atypical FGF subfamily, as it must be complexed to the Klotho co-receptor in order to bind to the FGF receptors and activate the downstream signaling pathway. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 μg/mL,measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 μg/mL mouse Klotho and 10 μg/mL heparin, corresponding to a specific activity of > 2 × 10^3 units/mg.
• Molecular Mass: 19.9 kDa, observed by reducing SDS-PAGE.
• AA Sequence: AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 97% as analyzed by SDS-PAGE& HPLC.
• Storage: Lyophilized recombinant Mouse Fibroblast Growth Factor-21(FGF-21), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse FGF-21 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Fgf21 fibroblast growth factor 21 [ Mus musculus ]
• Official Symbol: Fgf21
• Synonyms: FGF21; fibroblast growth factor 21; FGF-21
• Gene ID: 56636
• mRNA Refseq: NM_020013
• Protein Refseq: NP_064397
• UniProt ID: Q9JJN1