Active Recombinant Human FGF21 Protein (182 aa)

Cat.No. : FGF21-415F
Product Overview : Recombinant human Fibroblast Growth Factor-21 (rhFGF-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 182 amino acids. A fully biologically active molecule, rhFGF-21 has a molecular mass of 19.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 182
Description : Fibroblast Growth Factor-21 (FGF-21) is a metabolic cytokine belonging to the heparin-binding FGF family. Along with FGF-19/15 and FGF-23, FGF-21 is categorized as a member of the atypical FGF subfamily, as it must be complexed to the Klotho co-receptor in order to bind to the FGF receptors and activate the downstream signaling pathway. In vivo FGF-21 is expressed in liver, pancreas, adipose tissue, and skeletal muscle, and it plays a central role in the energy metabolism. The expression of FGF-21 is stimulated by free fatty acids and insulin resistant states and is correlated with whole-body insulin resistance. FGF-21 activates glucose uptake in adipocytes and increases insulin sensitivity, implicating it as a novel target with potential anti-diabetic properties.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 μg/mL, measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 μg/mL mouse Klotho and 10 μg/mL heparin, corresponding to a specific activity of > 2 × 10^3 units/mg.
Molecular Mass : 19.5 kDa, observed by reducing SDS-PAGE.
AA Sequence : GHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Fibroblast Growth Factor-21 (rhFGF-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-21 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name FGF21 fibroblast growth factor 21 [ Homo sapiens ]
Official Symbol FGF21
Synonyms FGF21; fibroblast growth factor 21; FGF-21;
Gene ID 26291
mRNA Refseq NM_019113
Protein Refseq NP_061986
MIM 609436
UniProt ID Q9NSA1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FGF21 Products

Required fields are marked with *

My Review for All FGF21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon