Active Recombinant Mouse Fgf10 Protein (148 aa)

• Cat.No.: Fgf10-420F
• Product Overview: Recombinant mouse Fibroblast Growth Factor-10 (rmFGF-10) produced in E. coli is a single non-glycosylated polypeptide chain containing 148 amino acids. A fully biologically active molecule, rmFGF-10 has a molecular mass of 17.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 148
• Description: Fibroblast Growth Factor-10 (FGF-10) is a mitogen mainly produced by mesenchymal stem cells in lung. FGF-10 belongs to the heparin binding FGF family, and is also known as Keratinocyte Growth Factor-2 (KGF-2). It shares homology with KGF, and both KGF and FGF-10 activate the receptor FGFR2-IIIb. However, unlike KGF, which induces the proliferation and differentiation of various epithelial cells, FGF-10 is an essential factor for the budding and branching morphogenesis during multi-organ development via mesenchymal-epithelial interactions. FGF-10 is crucial for lung and limb development and is regulated by Shh during early development.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 ng/mL, measured by a cell proliferation assay using 4MBr-5 cells, corresponding to a specific activity of > 1.0 × 10^5 units/mg.
• Molecular Mass: 17.0 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant mouse Fibroblast Growth Factor-10 (rmFGF-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-10 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Fgf10 fibroblast growth factor 10 [ Mus musculus ]
• Official Symbol: Fgf10
• Synonyms: FGF10; fibroblast growth factor 10; keratinocyte growth factor 2; Fgf-10; BB213776
• Gene ID: 14165
• mRNA Refseq: NM_008002
• Protein Refseq: NP_032028
• UniProt ID: O35565