Active Recombinant Human FGF10 Protein (169 aa)
| Cat.No. : | FGF10-421F |
| Product Overview : | Recombinant Human FGF-10 produced in E. coli is a single, non-glycosylated polypeptide chain containing 169 amino acids. A fully biologically active molecule, rhFGF-10 has a molecular mass of 19.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Fibroblast Growth Factor-10 (FGF-10) is a mitogen mainly produced by mesenchymal stem cells in the lung. FGF-10 belongs to the heparin binding FGF family, and is also known as Keratinocyte Growth Factor-2 (KGF-2). It shares homology with KGF and receptor binding to FGFR2-IIIb. However, while KGF induces proliferation and differentiation of various epithelial cells, FGF-10 promotes budding and branching morphogenesis during the multi-organ development via mesenchymal-epithelial cell interactions. FGF-10 is critical for lung and limb development, and is regulated by Shh during early development. |
| Source : | E. coli |
| Species : | Human |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 20 ng/mL, measured by a cell proliferation assay using 4 MBr-5 cells, corresponding to a specific activity of > 5.0 × 10^4 units/mg. |
| Molecular Mass : | 19.3 kDa, observed by reducing SDS-PAGE. |
| Protein length : | 169 |
| AA Sequence : | LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant Human FGF-10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human FGF-10 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
| Gene Name | FGF10 fibroblast growth factor 10 [ Homo sapiens ] |
| Official Symbol | FGF10 |
| Synonyms | FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; |
| Gene ID | 2255 |
| mRNA Refseq | NM_004465 |
| Protein Refseq | NP_004456 |
| MIM | 602115 |
| UniProt ID | O15520 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
0
Inquiry Basket
