Active Recombinant Mouse EGF Protein
Cat.No. : | EGF-75M |
Product Overview : | Recombinant Mouse EGF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Epidermal growth factor (EGF) is a growth factor that stimulates the proliferation, differentiation, and survival of epithelial and epidermal cells. EGF contains three intramolecular disulfide bonds and binds in high affinity to the epidermal growth factor receptor (EGFR). |
Bio-activity : | 3T3 cell proliferation, ≤250 pg/mL |
Molecular Mass : | Monomer, 6.2 kDa (54 aa) |
AA Sequence : | MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Egf epidermal growth factor [ Mus musculus (house mouse) ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF); AI790464; |
Gene ID | 13645 |
mRNA Refseq | NM_010113 |
Protein Refseq | NP_034243 |
UniProt ID | P01132 |
◆ Recombinant Proteins | ||
EGF-550H | Active Recombinant Human EGF, MIgG2a Fc-tagged | +Inquiry |
EGF-75M | Active Recombinant Mouse EGF Protein | +Inquiry |
EGF-2810D | Recombinant Dog EGF protein, His-tagged | +Inquiry |
EGF-262M | Active Recombinant Mouse EGF Protein | +Inquiry |
EGF-470H | Active Recombinant Human EGF, His-tagged | +Inquiry |
◆ Native Proteins | ||
Egf-635R | Native Rat Egf | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *
0
Inquiry Basket