Active Recombinant Mouse Cxcl12 Protein (78 aa)
Cat.No. : | Cxcl12-207C |
Product Overview : | Recombinant Mouse SDF-1 β/CXCL12 produced in CHO cells is a polypeptide chain containing 78 amino acids. A fully biologically active molecule, rm SDF-1β/CXCL12 has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Protein Length : | 78 |
Description : | SDF-1 α and SDF-1 β, members of the chemokine α subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 α and SDF-1 β cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 α and SDF-1 β are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 β and absent from SDF-1 α. SDF-1/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of mouse SDF-1/CXCL12 on Ca^2+ mobilization assay in CHO-K1/Gα15/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 2.5 μg/mL. |
Molecular Mass : | 8.5 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Mouse SDF-1 β/CXCL12 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse SDF-1β/CXCL12 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Cxcl12 chemokine (C-X-C motif) ligand 12 [ Mus musculus ] |
Official Symbol | Cxcl12 |
Synonyms | CXCL12; chemokine (C-X-C motif) ligand 12; stromal cell-derived factor 1; C-X-C motif chemokine 12; pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; thymic lymphoma cell-stimulating factor; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; Pbsf; Sdf1; Tlsf; Sdf1a; Sdf1b; Tlsfa; Tlsfb; Tpar1; Scyb12; AI174028; |
Gene ID | 20315 |
mRNA Refseq | NM_001012477 |
Protein Refseq | NP_001012495 |
UniProt ID | P40224 |
◆ Recombinant Proteins | ||
CXCL12-552H | Recombinant Human Chemokine (C-X-C motif) Ligand 12, HIgG1 Fc-tagged | +Inquiry |
CXCL12-932R | Recombinant Rhesus Macaque CXCL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxcl12-111R | Recombinant Rat Cxcl12 protein | +Inquiry |
Cxcl12-65R | Recombinant Rat Cxcl12 protein | +Inquiry |
CXCL12-4351R | Recombinant Rabbit CXCL12 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL12-3016HCL | Recombinant Human CXCL12 cell lysate | +Inquiry |
CXCL12-1863CCL | Recombinant Cynomolgus CXCL12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl12 Products
Required fields are marked with *
My Review for All Cxcl12 Products
Required fields are marked with *
0
Inquiry Basket