Recombinant Rat Cxcl12 protein

Cat.No. : Cxcl12-65R
Product Overview : Recombinant Rat Cxcl12 alpha protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. It is encoded by the CXCL12 gene. Rat CXCL12 is expressed as two isoforms that differ only in the C-terminal tail. And both SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. Contrast to SDF-1β, SDF-1α is shorter by four amino acids at the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. SDF-1 is highly conserved between species, rat CXCL12α shares approximately 96% amino acid sequence identity with human CXCL12α.
Source : E.coli
Species : Rat
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 50-100 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids.
Protein length : 68
AA Sequence : KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK
Endotoxin : Less than 1 EU/μg of rRtSDF-1α/CXCL12α as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag : Non
Gene Name Cxcl12
Official Symbol Cxcl12
Synonyms CXCL12; chemokine (C-X-C motif) ligand 12; SDF-1 gamma; Stromal cell-derived factor 1; stromal cell-derived factor-1 gamma; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); Sdf1;
Gene ID 24772
mRNA Refseq NM_001033882
Protein Refseq NP_001029054
UniProt ID Q9QZD1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cxcl12 Products

Required fields are marked with *

My Review for All Cxcl12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon