Active Recombinant Mouse Bmp4 Protein, His-Tagged
Cat.No. : | Bmp4-01M |
Product Overview : | Recombinant mouse Bmp4 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene. BMP4 is found on chromosome 14q22-q23. BMP4 is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. BMP4 is highly conserved evolutionarily. BMP4 is found in early embryonic development in the ventral marginal zone and in the eye, heart blood and otic vesicle. |
Form : | Lyophilized powder |
AA Sequence : | MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDK VVLKNYQEMVVEGCGCR with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <10 ng/mL. The specific activity of recombinant mouse BMP-4 is > 1 x 10^5 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 20 mM sodium carbonate, pH 4.5. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Bmp4 bone morphogenetic protein 4 [ Mus musculus (house mouse) ] |
Official Symbol | Bmp4 |
Synonyms | Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1 |
Gene ID | 12159 |
mRNA Refseq | NM_001316360.1 |
Protein Refseq | NP_001303289.1 |
UniProt ID | P21275 |
◆ Recombinant Proteins | ||
Bmp4-036M | Active Recombinant Mouse Bmp4 Protein | +Inquiry |
Bmp4-215R | Recombinant Rat Bmp4 protein, His/S-tagged | +Inquiry |
BMP4-575R | Recombinant Rabbit BMP4 protein, His-tagged | +Inquiry |
Bmp4-01M | Active Recombinant Mouse Bmp4 Protein, His-Tagged | +Inquiry |
BMP4-570P | Recombinant Pig BMP4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bmp4 Products
Required fields are marked with *
My Review for All Bmp4 Products
Required fields are marked with *
0
Inquiry Basket