Active Recombinant Mouse Bmp4 Protein

• Cat.No.: Bmp4-036M
• Product Overview: Purified recombinant protein of Mouse bone morphogenetic protein 4 (Bmp4) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Homozygous knockout mice die in utero, while a conditional knockout mouse exhibits defects in heart development. Transgenic mice overexpressing this gene in a neuron-specific manner exhibit a phenotype resembling the rare hereditary connective tissue disease, fibrodysplasia ossificans progressiva.
• Bio-activity: Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.
• Molecular Mass: 24 kDa
• AA Sequence: KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Bmp4 bone morphogenetic protein 4 [ Mus musculus (house mouse) ]
• Official Symbol: Bmp4
• Synonyms: Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1; bone morphogenetic protein 4; bone morphogenetic protein 2B
• Gene ID: 12159
• mRNA Refseq: NM_007554
• Protein Refseq: NP_031580
• UniProt ID: P21275