Active Recombinant Human TGFBR1, Fc-tagged, Biotinylated

• Cat.No.: TGFBR1-695H
• Product Overview: The recombinant human TGFBR1-Fc fusion protein is expressed as a 320 amino acid protein consisting of Leu34 - Glu125 region of TGFBR1 (UniProt accession #P36897) and a C-terminal Fc fusion from human IgG1, which exists as a dimer/tetramer/octamer under non-reducing condition.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized TGFBR1 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity.
• Molecular Mass: Calculated molecular mass (kDa): 35.6; Estimated by SDS-PAGE under reducing condition (kDa): ~45
• AA Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCN KIELPTTVKSSPGLGPVESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 34-125 a.a.

Gene Information

• Gene Name: TGFBR1 transforming growth factor, beta receptor 1 [ Homo sapiens ]
• Official Symbol: TGFBR1
• Synonyms: TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1
• Gene ID: 7046
• mRNA Refseq: NM_001130916
• Protein Refseq: NP_001124388
• MIM: 190181
• UniProt ID: P36897
• Chromosome Location: 9q22
• Pathway: ALK1 signaling events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem
• Function: ATP binding; I-SMAD binding; SMAD binding; SMAD binding; contributes_to growth factor binding; metal ion binding; nucleotide binding; protein binding; protein heterodimerization activity; protein serine/threonine kinase activity; receptor activity; transforming growth factor beta binding; contributes_to transforming growth factor beta binding; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; contributes_to transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; ubiquitin protein ligase binding