Recombinant Human transforming growth factor beta receptor 1 Protein, His tagged

• Cat.No.: TGFBR1-001H
• Product Overview: Recombinant Human TGFBR1 Protein (34-125aa) with C-His tag was expressed in HEK293.

Specification

• Description: The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: C-His
• Protein length: 34-125aa
• Molecular Mass: 11 kDa
• AA Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: PBS, pH 7.4
• Concentration: 1.0 mg/mL by BCA

Gene Information

• Gene Name: TGFBR1 transforming growth factor beta receptor 1 [ Homo sapiens (human) ]
• Official Symbol: TGFBR1
• Synonyms: TGFBR1; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I (activin A receptor type II like kinase, 53kD); TGF-beta receptor type-1; activin A receptor type II like kinase; 53kDa; ACVRLK4; ALK 5; tbetaR-I; TGF-beta receptor type I; TGF-beta type I receptor; activin receptor-like kinase 5; transforming growth factor beta receptor I; serine/threonine-protein kinase receptor R4; activin A receptor type II-like kinase, 53kD; activin A receptor type II-like kinase, 53kDa; transforming growth factor-beta receptor type I; activin A receptor type II-like protein kinase of 53kD; transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD); AAT5; ALK5; MSSE; SKR4; ALK-5; LDS1A; LDS2A; TGFR-1
• Gene ID: 7046
• mRNA Refseq: NM_001130916
• Protein Refseq: NP_001124388
• MIM: 190181
• UniProt ID: P36897