Active Recombinant Human TGFA Protein

• Cat.No.: TGFA-205T
• Product Overview: Recombinant Human TGFA Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Protransforming Growth Factor-alpha (TGF-alpha), also known as sarcoma growth factor, TGF-type I and ETGF, is a member of the EGF family of cytokines. It is expressed in monocytes, brain cells, keratinocytes and various tumor cells. ProTGF-alpha signals through EGFR and acts synergistically with TGF-beta to promote the proliferation of a wide range of epidermal and epithelial cells. It may function as either a membrane-bound ligand or a soluble ligand. Membrane-bound proTGF-alpha plays a role in cell-cell adhesion and juxtacrine stimulation of adjacent cells. The soluble form of the cytokine is released from the membrane-bound form by proteolytic cleavage and acts as a mitogen for cell proliferation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.4 ng/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: 8-10 kDa, observed by reducing SDS-PAGE.
• AA Sequence: VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human TGF-alpha remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human TGF-alpha Receptor should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: TGFA transforming growth factor alpha [ Homo sapiens (human) ]
• Official Symbol: TGFA
• Synonyms: TGFA; transforming growth factor alpha; protransforming growth factor alpha; TGF-alpha
• Gene ID: 7039
• mRNA Refseq: NM_003236
• Protein Refseq: NP_003227
• MIM: 190170
• UniProt ID: P01135