Active Recombinant Human TFF2 Protein (106 aa)

Cat.No. : TFF2-049T
Product Overview : Recombinant Human TFF2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 106
Description : The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are expressed in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF2 has been shown to inhibit gastrointestinal motility and gastric acid secretion. Recent data suggests a potential role for TFF2 in acute and chronic asthma (Nikolaidis, N.M. et al. Am. Journal Respir. Cell Mol. Biol. (2003) 4: 458-464).
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard.Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 μg/mL, corresponding to a Specific Activity of >100 IU/mg.
Molecular Mass : 12.0 kDa, a single non-glycosylated polypeptide chain containing 106 amino acids.
AA Sequence : EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Endotoxin : Less than 1 EU/μg of rHuTFF-2 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name TFF2 trefoil factor 2 [ Homo sapiens ]
Official Symbol TFF2
Synonyms TFF2; trefoil factor 2; SML1, spasmolytic protein 1; spasmolysin; spasmolytic protein 1; spasmolytic polypeptide; SP; SML1;
Gene ID 7032
mRNA Refseq NM_005423
Protein Refseq NP_005414
MIM 182590
UniProt ID Q03403

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TFF2 Products

Required fields are marked with *

My Review for All TFF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon