Active Recombinant Human TFF1 Protein
Cat.No. : | TFF1-050T |
Product Overview : | Recombinant Human TFF1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are expressed in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF1 is essential for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard.Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1.0-2.0 μg/mL, corresponding to a Specific Activity of >500 IU/mg. |
Molecular Mass : | 13.2 kDa homodimeric protein consisting of two 60 amino acid polypeptide chains, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds. |
AA Sequence : | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
Endotoxin : | Less than 1 EU/μg of rHuTFF1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TFF1 trefoil factor 1 [ Homo sapiens ] |
Official Symbol | TFF1 |
Synonyms | TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; gastrointestinal trefoil protein pS2; breast cancer estrogen-inducible protein; breast cancer estrogen-inducible sequence; BCEI; pNR-2; |
Gene ID | 7031 |
mRNA Refseq | NM_003225 |
Protein Refseq | NP_003216 |
MIM | 113710 |
UniProt ID | P04155 |
◆ Recombinant Proteins | ||
TFF1-16690M | Recombinant Mouse TFF1 Protein, His-tagged | +Inquiry |
TFF1-050T | Active Recombinant Human TFF1 Protein | +Inquiry |
TFF1-244H | Active Recombinant Full Length Human TFF1 protein, Tag Free | +Inquiry |
TFF1-6417H | Recombinant Human TFF1 Protein (Met1-Phe84), N-His tagged | +Inquiry |
TFF1-674H | Recombinant Human TFF1 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFF1-1127HCL | Recombinant Human TFF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFF1 Products
Required fields are marked with *
My Review for All TFF1 Products
Required fields are marked with *
0
Inquiry Basket