Active Recombinant Human ST6GALNAC2 Protein (AA 68-374), N-6×His/GFP tagged
Cat.No. : | ST6GALNAC2-16H |
Product Overview : | Recombinant Human ST6GALNAC2 Protein (AA 68-374) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 68-374 |
Description : | ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]). |
Bio-activity : | ≥0.084 μmol/min/mg |
Molecular Mass : | ~65-70 kDa |
AA Sequence : | SWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR |
Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | ST6GALNAC2 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | ST6GALNAC2 |
Synonyms | ST6GALNAC2; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; sialyltransferase 7 ((alpha N acetylneuraminyl 2,3 beta galactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialyltransferase) , sialyltransferase like 1 , SIAT7, SIAT7B, SIATL1; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; ST6GalNAII; STHM; SIAT7-B; ST6GalNAcII; ST6GalNAc II; sialyltransferase 7B; sialyltransferase-like 1; galNAc alpha-2,6-sialyltransferase II; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) B; SIAT7; SAITL1; SIAT7B; SIATL1; FLJ45660; |
Gene ID | 10610 |
mRNA Refseq | NM_006456 |
Protein Refseq | NP_006447 |
MIM | 610137 |
UniProt ID | Q9UJ37 |
◆ Recombinant Proteins | ||
ST6GALNAC2-195H | Recombinant Human ST6GALNAC2, His-tagged | +Inquiry |
St6galnac2-3379M | Recombinant Mouse St6galnac2, His-tagged | +Inquiry |
ST6GALNAC2-16H | Active Recombinant Human ST6GALNAC2 Protein (AA 68-374), N-6×His/GFP tagged | +Inquiry |
ST6GALNAC2-2979H | Recombinant Human ST6GALNAC2, His-tagged | +Inquiry |
RFL6619MF | Recombinant Full Length Mouse Alpha-N-Acetylgalactosaminide Alpha-2,6-Sialyltransferase 2(St6Galnac2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST6GALNAC2-1613MCL | Recombinant Mouse ST6GALNAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ST6GALNAC2 Products
Required fields are marked with *
My Review for All ST6GALNAC2 Products
Required fields are marked with *
0
Inquiry Basket