Active Recombinant Human ST6GALNAC2 Protein (AA 68-374), N-6×His/GFP tagged

Description :	ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]).
Source :	HEK293
Species :	Human
Tag :	His&GFP
Bio-activity :	≥0.084 μmol/min/mg
Molecular Mass :	~65-70 kDa
Protein length :	AA 68-374
AA Sequence :	SWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR
Purity :	>95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability :	6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration :	1 mg/mL
Storage Buffer :	Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative :	0.05 % NaN3
Shipping :	This product is shipped as 0.2μm filtered product on dry ice.

Gene Name	ST6GALNAC2 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 [ Homo sapiens (human) ]
Official Symbol	ST6GALNAC2
Synonyms	ST6GALNAC2; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; sialyltransferase 7 ((alpha N acetylneuraminyl 2,3 beta galactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialyltransferase) , sialyltransferase like 1 , SIAT7, SIAT7B, SIATL1; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; ST6GalNAII; STHM; SIAT7-B; ST6GalNAcII; ST6GalNAc II; sialyltransferase 7B; sialyltransferase-like 1; galNAc alpha-2,6-sialyltransferase II; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) B; SIAT7; SAITL1; SIAT7B; SIATL1; FLJ45660;
Gene ID	10610
mRNA Refseq	NM_006456
Protein Refseq	NP_006447
MIM	610137
UniProt ID	Q9UJ37

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry