Active Recombinant Human ST2 Protein

• Cat.No.: IL1RL1-1009H
• Product Overview: Recombinant Human ST2 also known as interleukin-1receptor-like 1 antigen is produced by mammalian expression system and the target gene encoding Lys19- Phe328 is expressed with a 6His tag at the C-terminus. Predicted molecular weight: 60 kDa.

Specification

• Description: ST2 is an interleukin-1 family receptor expressed in the heart. ST2 protein has two isoforms: a soluble (sST2) and membrane- bound form. Patients with heart failure and elevated ST2 protein levels in the blood are at risk for heart failure progression.
• Source: Human cells
• Species: Human
• Tag: His
• Form: Lyophilized
• Bio-activity: Anti-h ST2 10201: + Anti-h ST2 10202: + Anti-h ST2 10203: + Anti-h ST2 10204: + Anti-h ST2 10205: + Anti-h ST2 10206: + Anti-h ST2 10207: +
• Molecular Mass: 60kDa
• AA Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSG IYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWF KNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPV IGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSN GLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECFVDHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: -20centigrade
• Concentration: 0.5 mg/ml when reconstituted with 100 µl of deionized wate
• Storage Buffer: 20 mM Na-phosphate, pH 7.4, 150 mM NaCl
• Reconstitution: Reconstitute lyophilized protein with 100 µl of deionized water

Gene Information

• Gene Name: IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ]
• Official Symbol: IL1RL1
• Synonyms: IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623
• Gene ID: 9173
• mRNA Refseq: NM_003856
• Protein Refseq: NP_003847
• MIM: 601203
• UniProt ID: Q01638