Recombinant Human IL1RL1 protein, T7/His-tagged

• Cat.No.: IL1RL1-144H
• Product Overview: Recombinant extracellular domain of human IL1RL1 cDNA (19 – 328aa, Isoform-II, derived from BC030975) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 19-328 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQER NRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTID LYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFP VIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVL RIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro IL1RL1 mediated T cell activation in IL-33 regulatory pathway study with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping IL1RL1 protein-protein interaction.3. Potential biomarker protein for diagnostic applications, such as preeclampsia or GVHD et al.4. As immunogen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ]
• Official Symbol: IL1RL1
• Synonyms: IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623
• Gene ID: 9173
• mRNA Refseq: NM_003856
• Protein Refseq: NP_003847
• MIM: 601203
• UniProt ID: Q01638
• Chromosome Location: 2q12
• Function: cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity