Active Recombinant Human RAET1L Protein, His-tagged

• Cat.No.: RAET1L-02H
• Product Overview: Recombinant human RAET1L (26-218aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• ProteinLength: 26-218aa
• Description: RAET1L belongs to the RAET1 family of major histocompatibility complex (MHC) class I-related genes, which are located within a 180-kb cluster on chromosome 6q24.2-q25.3. The REAT1 genes encode glycoproteins that contain extracellular alpha-1 and alpha-2 domains, but they lack the membrane proximal Ig-like alpha-3 domain. Most RAET1 glycoproteins are anchored to the membrane via glycosylphosphatidylinositol (GPI) linkage.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human NKG2D.
• Molecular Mass: 22.9kDa (202aa)
• AA Sequence: RRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: RAET1L retinoic acid early transcript 1L [ Homo sapiens (human) ]
• Official Symbol: RAET1L
• Synonyms: RAET1L; retinoic acid early transcript 1L; ULBP6; UL16-binding protein 6; UL16 binding protein 6; retinoic acid early transcript 1L protein
• Gene ID: 154064
• mRNA Refseq: NM_130900
• Protein Refseq: NP_570970
• MIM: 611047
• UniProt ID: Q5VY80