Active Recombinant Human OSM Protein
Cat.No. : | OSM-220H |
Product Overview : | Recombinant Human OSM Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Oncostatin M is a cytokine that is produced by macrophages, dendritic cells, and T lymphocytes during inflammatory events. The Type-I and Type-II Oncostatin M receptors are located on the cell surface of endothelial and tumor cells, contain the glycoprotein 130 (gp130) subunit, and activate the JAK/STAT signaling pathway. Oncostatin M functions to inhibit tumor cell proliferation, induce liver stem cell maturation, regulate cytokine production during hematopoiesis and inflammation, stimulate bone formation, and promote nervous system development. |
Bio-activity : | TF-1 cell proliferation, ≤4 ng/mL |
Molecular Mass : | Monomer, 23.8 kDa (210 aa) |
AA Sequence : | MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | OSM oncostatin M [ Homo sapiens (human) ] |
Official Symbol | OSM |
Synonyms | OSM; oncostatin M; oncostatin-M; MGC20461; |
Gene ID | 5008 |
mRNA Refseq | NM_020530 |
Protein Refseq | NP_065391 |
MIM | 165095 |
UniProt ID | P13725 |
◆ Recombinant Proteins | ||
OSM-4391S | Recombinant Swine OSM Protein | +Inquiry |
OSM-111H | Recombinant Human OSM Protein, His-tagged | +Inquiry |
Osm-168O | Active Recombinant Mouse Osm Protein | +Inquiry |
OSM-259H | Recombinant Human OSM, StrepII-tagged | +Inquiry |
OSM-6998H | Active Recombinant Human OSM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
0
Inquiry Basket