Active Recombinant Human OSM, Fc-tagged

• Cat.No.: OSM-658H
• Product Overview: The recombinant human OSM-Fc is expressed as a 433-amino acid active form consisting of Ala26 - Arg220 region of (UniProt accession #P13725) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.2 - 0.5 ng/ml. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
• Molecular Mass: Calculated molecular mass (kDa): 48.7; Estimated by SDS-PAGE under reducing condition (kDa): ~55
• AA Sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLN ATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQ PPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRSTTENLYFQGSTGTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 26-220 a.a.

Gene Information

• Gene Name: OSM oncostatin M [ Homo sapiens ]
• Official Symbol: OSM
• Synonyms: OSM; oncostatin M; oncostatin-M; MGC20461
• Gene ID: 5008
• mRNA Refseq: NM_020530
• Protein Refseq: NP_065391
• MIM: 165095
• UniProt ID: P13725
• Chromosome Location: 22q12.2
• Pathway: Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: cytokine activity; growth factor activity; oncostatin-M receptor binding