Active Recombinant Human NTF4 Protein (131 aa)

• Cat.No.: NTF4-324N
• Product Overview: Recombinant human Neurotrophin-4 (rhNT-4) produced in E. coli is a noncovalently linked homodimer containing two non-glycosylated polypeptide chains of 131 amino acids. A fully biologically active molecule, rhNT-4 has a molecular mass of 28.1kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 131
• Description: Neurotrophin-4 (NT-4), also known as NT-5, is a neurotrophic factor structurally related to β-NGF, BDNF, and NT-3. Human NT-4 shares 48 - 52% aa sequence identity with human β-NGF, BDNF, and NT-3.Neurotrophins have six conserved cysteine residues that are involved in the formation of three disulfide bonds. NT-4 is expressed highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. NT-4 binds and induces receptor dimerization and activation of TrkB. NT-4 can signal through TrkB receptors and promotes the survival of peripheral sensory sympathetic neurons.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5.0 μg/mL, measured by a cell proliferation assay using C6 cells, corresponding to a specific activity of > 2.0 × 10^2 units/mg.
• Molecular Mass: 28.1 kDa, a noncovalently linked homodimer,of two 14.0 kDa polypeptide monomers.
• AA Sequence: MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
• Endotoxin: < 0.3 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Neurotrophin-4 (rhNT-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhNT-4 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50mM acetic acid.
• Reconstitution: Reconstituted in 50mM acetic acid or ddH2O at 50 μg/mL.

Gene Information

• Gene Name: NTF4 neurotrophin 4 [ Homo sapiens ]
• Official Symbol: NTF4
• Synonyms: NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5), NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5
• Gene ID: 4909
• mRNA Refseq: NM_006179
• Protein Refseq: NP_006170
• MIM: 162662
• UniProt ID: P34130