Recombinant Human NTF4 protein, His-tagged
Cat.No. : | NTF4-3294H |
Product Overview : | Recombinant Human NTF4 protein(P34130)(82-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 82-210aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NTF4 neurotrophin 4 [ Homo sapiens ] |
Official Symbol | NTF4 |
Synonyms | NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5; |
Gene ID | 4909 |
mRNA Refseq | NM_006179 |
Protein Refseq | NP_006170 |
MIM | 162662 |
UniProt ID | P34130 |
◆ Recombinant Proteins | ||
NTF4-162H | Recombinant Human NTF4 protein, His/S-tagged | +Inquiry |
NTF4-1309H | Recombinant Human NTF4 protein(Gly81-Ala210) | +Inquiry |
NTF4-013H | Active Recombinant Human NTF4 | +Inquiry |
NTF4-3760R | Recombinant Rat NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NTF4-16H | Recombinant Human NTF4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTF4-3669HCL | Recombinant Human NTF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTF4 Products
Required fields are marked with *
My Review for All NTF4 Products
Required fields are marked with *
0
Inquiry Basket