Active Recombinant Human NOG Protein (206 aa)

• Cat.No.: NOG-066N
• Product Overview: Recombinant Human NOG Protein without tag was expressed in E. coli.

Specification

• Description: Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The ED50 was determined by its ability to inhibit 5.0 ng/mL of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 μg/mL of NOGGIN, corresponding to a Specific Activity of ＞1.25 × 10^4 IU/mg.
• Molecular Mass: Approximately 46.2 kDa non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
• Protein length: 206
• AA Sequence: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
• Endotoxin: Less than 1 EU/μg of rHu NOGGIN as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: NOG noggin [ Homo sapiens ]
• Official Symbol: NOG
• Synonyms: NOG; noggin; SYM1, symphalangism 1 (proximal), synostoses (multiple) syndrome 1, SYNS1; symphalangism 1 (proximal); SYM1; SYNS1
• Gene ID: 9241
• mRNA Refseq: NM_005450
• Protein Refseq: NP_005441
• MIM: 602991
• UniProt ID: Q13253