Recombinant Human GDF11 protein

Description :	This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging.
Source :	E. coli
Species :	Human
Form :	20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT
Molecular Mass :	~13 kDa
AA Sequence :	NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Purity :	> 95% as determined by SDS-PAGE
Storage :	Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
Concentration :	0.1 mg/ml
Tag :	Non

Gene Name	GDF11 growth differentiation factor 11 [ Homo sapiens ]
Official Symbol	GDF11
Synonyms	GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11;
Gene ID	10220
mRNA Refseq	NM_005811
Protein Refseq	NP_005802
MIM	603936
UniProt ID	O95390
Chromosome Location	12q13.13
Function	cytokine activity; growth factor activity;