Active Recombinant Human IL22 Protein

• Cat.No.: IL22-178I
• Product Overview: Recombinant Human IL22 Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Interleukin-22 (IL-22) is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-ß/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Active, measured by its ability to activate STAT following receptor ligand interaction.
• Molecular Mass: 16~28 kDa, observed by reducing SDS-PAGE.
• AA Sequence: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Interleukin-22 (IL-22) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-22 (IL-22) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL22 interleukin 22 [ Homo sapiens ]
• Official Symbol: IL22
• Synonyms: IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23
• Gene ID: 50616
• mRNA Refseq: NM_020525
• Protein Refseq: NP_065386
• MIM: 605330
• UniProt ID: Q9GZX6