Active Recombinant Mouse Il22 Protein

• Cat.No.: Il22-146M
• Product Overview: Purified recombinant protein of Mouse interleukin 22 (Il22) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine that contributes to the inflammatory response in vivo.
• Bio-activity: Assay#1: Determined by its ability to activate STAT following receptor ligand interaction. Assay#2:Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The expected ED50 for this effect is 1.0-2.0 ng/ml.
• Molecular Mass: 22.4 kDa
• AA Sequence: MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il22 interleukin 22 [ Mus musculus (house mouse) ]
• Official Symbol: Il22
• Synonyms: Il22; interleukin 22; IL-22; Iltif; IL-22a; ILTIFa; interleukin-22; IL-10-related T-cell-derived-inducible factor; IL-TIF alpha; ILTIF alpha; interleukin 10-related T cell-derived inducible factor; interleukin-22a
• Gene ID: 50929
• mRNA Refseq: NM_016971
• Protein Refseq: NP_058667
• UniProt ID: Q9JJY9