Active Recombinant Mouse Il22 Protein
Cat.No. : | Il22-146M |
Product Overview : | Purified recombinant protein of Mouse interleukin 22 (Il22) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine that contributes to the inflammatory response in vivo. |
Bio-activity : | Assay#1: Determined by its ability to activate STAT following receptor ligand interaction. Assay#2:Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The expected ED50 for this effect is 1.0-2.0 ng/ml. |
Molecular Mass : | 22.4 kDa |
AA Sequence : | MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Il22 interleukin 22 [ Mus musculus (house mouse) ] |
Official Symbol | Il22 |
Synonyms | Il22; interleukin 22; IL-22; Iltif; IL-22a; ILTIFa; interleukin-22; IL-10-related T-cell-derived-inducible factor; IL-TIF alpha; ILTIF alpha; interleukin 10-related T cell-derived inducible factor; interleukin-22a |
Gene ID | 50929 |
mRNA Refseq | NM_016971 |
Protein Refseq | NP_058667 |
UniProt ID | Q9JJY9 |
◆ Recombinant Proteins | ||
Il22-549M | Recombinant Mouse Il22 protein | +Inquiry |
Il22-178M | Recombinant Active Mouse IL22 Protein, His-tagged(C-ter) | +Inquiry |
IL22-4349C | Recombinant Caprine IL22 Protein | +Inquiry |
Il22-28M | Recombinant Mouse Interleukin-22 | +Inquiry |
IL22-098I | Active Recombinant Human IL22 Protein (146 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il22 Products
Required fields are marked with *
My Review for All Il22 Products
Required fields are marked with *
0
Inquiry Basket