Active Recombinant Human IL1B Protein

Cat.No. : IL1B-132H
Product Overview : Recombinant human IL-1beta (117-269aa) without tag was expressed in E.coli and purified by using conventional chromatography techniques.
Availability April 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 117-269 a.a.
Description : Interleukin-1 (IL-1) has been considered a potentially important inflammatory mediator. It is composed of two distinct proteins, called as IL-1alpha and IL-1beta. IL-1beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and they are structurally related polypeptides that share approximately 20% amino acid.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is less or euqal to 0.005 ng/ml.
Molecular Mass : 17 kDa
AA Sequence : MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Endotoxin : < 1.0 EU per 1 microgram of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Storage : Can be stored at 4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by BCA assay)
Storage Buffer : PBS pH7.4
Gene Name IL1B
Official Symbol IL1B interleukin 1 beta [ Homo sapiens (human) ]
Synonyms IL1B; interleukin 1 beta; IL-1; IL1F2; IL1-BETA; interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta
Gene ID 3553
mRNA Refseq NM_000576
Protein Refseq NP_000567
MIM 147720
UniProt ID P01584

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL1B Products

Required fields are marked with *

My Review for All IL1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon