Active Recombinant Human IL1B Protein

• Cat.No.: IL1B-132H
• Product Overview: Recombinant human IL-1beta (117-269aa) without tag was expressed in E.coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 117-269 a.a.
• Description: Interleukin-1 (IL-1) has been considered a potentially important inflammatory mediator. It is composed of two distinct proteins, called as IL-1alpha and IL-1beta. IL-1beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta bind to the same receptor and they are structurally related polypeptides that share approximately 20% amino acid.
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is less or euqal to 0.005 ng/ml.
• Molecular Mass: 17 kDa
• AA Sequence: MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Endotoxin: < 1.0 EU per 1 microgram of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Storage: Can be stored at 4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by BCA assay)
• Storage Buffer: PBS pH7.4

Gene Information

• Gene Name: IL1B
• Official Symbol: IL1B interleukin 1 beta [ Homo sapiens (human) ]
• Synonyms: IL1B; interleukin 1 beta; IL-1; IL1F2; IL1-BETA; interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta
• Gene ID: 3553
• mRNA Refseq: NM_000576
• Protein Refseq: NP_000567
• MIM: 147720
• UniProt ID: P01584