Active Recombinant Human IL18BP Protein

• Cat.No.: IL18BP-252I
• Product Overview: Recombinant Human IL18BP Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Interleukin-18 binding protein, also known as IL-18BP and tadekinig-alfa, is a secreted glycoprotein that contains an Ig-like C2-type domain. It is expressed in heart, lung, placenta and spleen. IL-18BP functions as an inhibitor of the proinflammatory cytokine IL-18. It binds to IL-18, prevents the binding of IL-18 to its receptor, and thus blocks IL-18-induced IFN-gamma production. The complete Ig domain has been shown to mediate the binding and neutralizing properties. IFN-gamma is able to upregulate the expression of IL-18BP, indicating that IL-18 activity is regulated by a feedback mechanism through IL-18BP.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 30 ng/mL, measured in a bioassay using KG-1 cells in the presence of 50 ng/mL Human IL-18.
• Molecular Mass: 42-44 kDa, observed by reducing SDS-PAGE.
• AA Sequence: TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human IL-18BP remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human IL-18BP should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL18BP interleukin 18 binding protein [ Homo sapiens ]
• Official Symbol: IL18BP
• Synonyms: IL18BP; interleukin 18 binding protein; interleukin-18-binding protein; IL18BPa; MC51L 53L 54L homolog gene product; IL-18BP; tadekinig-alfa; MC51L-53L-54L homolog gene product
• Gene ID: 10068
• mRNA Refseq: NM_001039659
• Protein Refseq: NP_001034748
• MIM: 604113
• UniProt ID: O95998