Active Recombinant Human IL13 Protein
Cat.No. : | IL13-255I |
Product Overview : | Recombinant human interleukin 13 expressed in CHO cells is glycosylated protein with molecular weight range from 25 to 45 kDa shown in non-reducing SDS-PAGE. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and mouse IL-13 is cross-species reactive. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 15 ng/mL, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 6.7 × 10^5 units/mg. |
Molecular Mass : | 25-45 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human Interleukin 13 (IL-13) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-13 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL13 interleukin 13 [ Homo sapiens ] |
Official Symbol | IL13 |
Synonyms | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13; |
Gene ID | 3596 |
mRNA Refseq | NM_002188 |
Protein Refseq | NP_002179 |
MIM | 147683 |
UniProt ID | P35225 |
◆ Recombinant Proteins | ||
IL13-505H | Recombinant Human IL13 Protein | +Inquiry |
IL13-308C | Active Recombinant Cynomolgus IL13 protein | +Inquiry |
Il13-49M | Active Recombinant Mouse Il13 Protein (Pro22-Fhe131), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL13-147H | Recombinant Human IL13 protein, hFc-tagged | +Inquiry |
IL13-255I | Active Recombinant Human IL13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *
0
Inquiry Basket