Active Recombinant Human IL13 Protein

• Cat.No.: IL13-255I
• Product Overview: Recombinant human interleukin 13 expressed in CHO cells is glycosylated protein with molecular weight range from 25 to 45 kDa shown in non-reducing SDS-PAGE.

Specification

• Species: Human
• Source: CHO
• Description: Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1beta, TNF-alpha, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and mouse IL-13 is cross-species reactive.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 15 ng/mL, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 6.7 × 10^5 units/mg.
• Molecular Mass: 25-45 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant human Interleukin 13 (IL-13) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-13 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL13 interleukin 13 [ Homo sapiens ]
• Official Symbol: IL13
• Synonyms: IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13
• Gene ID: 3596
• mRNA Refseq: NM_002188
• Protein Refseq: NP_002179
• MIM: 147683
• UniProt ID: P35225