Active Recombinant Human IL11 Protein

• Cat.No.: IL11-259I
• Product Overview: Recombinant Human IL11 Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Interleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple effects on both hematopoietic and non-hematopoietic cells. Many of the biological effects described for IL-11 overlap with those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell-dependent development of specific immunoglobulin-secreting B cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 ng/mL, measured in a proliferation assay using T11 cells.
• Molecular Mass: ~23 kDa, observed by reducing SDS-PAGE.
• AA Sequence: PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Human Interleukin-11 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-11 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL11 interleukin 11 [ Homo sapiens ]
• Official Symbol: IL11
• Synonyms: IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11
• Gene ID: 3589
• mRNA Refseq: NM_000641
• Protein Refseq: NP_000632
• MIM: 147681
• UniProt ID: P20809