Active Recombinant Human IL11 Protein
Cat.No. : | IL11-259I |
Product Overview : | Recombinant Human IL11 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple effects on both hematopoietic and non-hematopoietic cells. Many of the biological effects described for IL-11 overlap with those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell-dependent development of specific immunoglobulin-secreting B cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 ng/mL, measured in a proliferation assay using T11 cells. |
Molecular Mass : | ~23 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human Interleukin-11 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-11 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL11 interleukin 11 [ Homo sapiens ] |
Official Symbol | IL11 |
Synonyms | IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11; |
Gene ID | 3589 |
mRNA Refseq | NM_000641 |
Protein Refseq | NP_000632 |
MIM | 147681 |
UniProt ID | P20809 |
◆ Recombinant Proteins | ||
Il11-586M | Recombinant Mouse interleukin 11 | +Inquiry |
IL11-2519H | Recombinant Human IL11 Protein (Pro22-Leu199), His tagged | +Inquiry |
IL11-953H | Active Recombinant Human IL11 Protein | +Inquiry |
IL11-2016H | Recombinant Human IL11 Protein, Met-tagged | +Inquiry |
Il11-182I | Active Recombinant Mouse Il11 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL11 Products
Required fields are marked with *
My Review for All IL11 Products
Required fields are marked with *
0
Inquiry Basket